Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 1721024..1721821 | Replicon | chromosome |
Accession | NZ_CP117723 | ||
Organism | Enterobacter asburiae strain 2022CK-00757 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | PTC87_RS08155 | Protein ID | WP_172421424.1 |
Coordinates | 1721321..1721821 (+) | Length | 167 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | W7PG43 |
Locus tag | PTC87_RS08150 | Protein ID | WP_008499829.1 |
Coordinates | 1721024..1721293 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC87_RS08120 (PTC87_08120) | 1716651..1717094 | - | 444 | WP_032658095.1 | helix-turn-helix domain-containing protein | - |
PTC87_RS08125 (PTC87_08125) | 1717247..1718488 | + | 1242 | WP_033145159.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
PTC87_RS08130 (PTC87_08130) | 1718522..1718749 | - | 228 | WP_033145160.1 | YccJ family protein | - |
PTC87_RS08135 (PTC87_08135) | 1718770..1719366 | - | 597 | WP_023311076.1 | NAD(P)H:quinone oxidoreductase | - |
PTC87_RS08140 (PTC87_08140) | 1719757..1719927 | + | 171 | WP_023311077.1 | general stress protein | - |
PTC87_RS08145 (PTC87_08145) | 1720045..1720962 | + | 918 | WP_033145161.1 | DMT family transporter | - |
PTC87_RS08150 (PTC87_08150) | 1721024..1721293 | + | 270 | WP_008499829.1 | DUF1778 domain-containing protein | Antitoxin |
PTC87_RS08155 (PTC87_08155) | 1721321..1721821 | + | 501 | WP_172421424.1 | GNAT family N-acetyltransferase | Toxin |
PTC87_RS08160 (PTC87_08160) | 1721895..1723217 | - | 1323 | WP_033145163.1 | pyrimidine utilization transport protein G | - |
PTC87_RS08165 (PTC87_08165) | 1723239..1723733 | - | 495 | WP_032658088.1 | pyrimidine utilization flavin reductase protein F | - |
PTC87_RS08170 (PTC87_08170) | 1723743..1724333 | - | 591 | WP_033145164.1 | malonic semialdehyde reductase | - |
PTC87_RS08175 (PTC87_08175) | 1724343..1725143 | - | 801 | WP_033145165.1 | pyrimidine utilization protein D | - |
PTC87_RS08180 (PTC87_08180) | 1725151..1725537 | - | 387 | WP_033145166.1 | pyrimidine utilization protein C | - |
PTC87_RS08185 (PTC87_08185) | 1725549..1726238 | - | 690 | WP_033145167.1 | pyrimidine utilization protein B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 18969.67 Da Isoelectric Point: 7.9145
>T272163 WP_172421424.1 NZ_CP117723:1721321-1721821 [Enterobacter asburiae]
MLSEGTDYDFEDFDCGEPSLNAFLAEHLVRQHNGRILRAYLLKERDRPRVLGYYTLSGSCFERAMLPSKTQQRRIPYINV
PSVTLGRLAVDKTLQGNEWGTTLVAHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKQGFIPLTAENSHSLFFPTKSIE
RLFEQE
MLSEGTDYDFEDFDCGEPSLNAFLAEHLVRQHNGRILRAYLLKERDRPRVLGYYTLSGSCFERAMLPSKTQQRRIPYINV
PSVTLGRLAVDKTLQGNEWGTTLVAHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKQGFIPLTAENSHSLFFPTKSIE
RLFEQE
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|