Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1054204..1054824 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | PTC87_RS04940 | Protein ID | WP_008499287.1 |
| Coordinates | 1054204..1054422 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | PTC87_RS04945 | Protein ID | WP_008499288.1 |
| Coordinates | 1054450..1054824 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS04910 (PTC87_04910) | 1050218..1050478 | + | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
| PTC87_RS04915 (PTC87_04915) | 1050481..1050621 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| PTC87_RS04920 (PTC87_04920) | 1050618..1051328 | - | 711 | WP_033144788.1 | GNAT family protein | - |
| PTC87_RS04925 (PTC87_04925) | 1051430..1052890 | + | 1461 | WP_033144789.1 | PLP-dependent aminotransferase family protein | - |
| PTC87_RS04930 (PTC87_04930) | 1052862..1053329 | - | 468 | WP_023310598.1 | YlaC family protein | - |
| PTC87_RS04935 (PTC87_04935) | 1053447..1053998 | - | 552 | WP_033144790.1 | maltose O-acetyltransferase | - |
| PTC87_RS04940 (PTC87_04940) | 1054204..1054422 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
| PTC87_RS04945 (PTC87_04945) | 1054450..1054824 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| PTC87_RS04950 (PTC87_04950) | 1055336..1058482 | - | 3147 | WP_029741964.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PTC87_RS04955 (PTC87_04955) | 1058505..1059698 | - | 1194 | WP_029741963.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T272162 WP_008499287.1 NZ_CP117723:c1054422-1054204 [Enterobacter asburiae]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT272162 WP_008499288.1 NZ_CP117723:c1054824-1054450 [Enterobacter asburiae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8SI38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |