Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 590668..591244 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A4R0G892 |
| Locus tag | PTC87_RS02750 | Protein ID | WP_010427219.1 |
| Coordinates | 590668..590955 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A411GC49 |
| Locus tag | PTC87_RS02755 | Protein ID | WP_033144548.1 |
| Coordinates | 590942..591244 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS02725 (PTC87_02725) | 585784..586479 | + | 696 | WP_033144544.1 | winged helix-turn-helix domain-containing protein | - |
| PTC87_RS02730 (PTC87_02730) | 586629..587099 | + | 471 | WP_033144545.1 | MarR family transcriptional regulator | - |
| PTC87_RS02735 (PTC87_02735) | 587096..588163 | + | 1068 | WP_101744430.1 | HlyD family secretion protein | - |
| PTC87_RS02740 (PTC87_02740) | 588153..589229 | + | 1077 | WP_023310256.1 | DUF2955 domain-containing protein | - |
| PTC87_RS02745 (PTC87_02745) | 589226..590497 | - | 1272 | WP_033144547.1 | DUF445 domain-containing protein | - |
| PTC87_RS02750 (PTC87_02750) | 590668..590955 | + | 288 | WP_010427219.1 | BrnT family toxin | Toxin |
| PTC87_RS02755 (PTC87_02755) | 590942..591244 | + | 303 | WP_033144548.1 | BrnA antitoxin family protein | Antitoxin |
| PTC87_RS02760 (PTC87_02760) | 591275..591913 | - | 639 | WP_033144549.1 | LysE family translocator | - |
| PTC87_RS02765 (PTC87_02765) | 591961..592704 | - | 744 | WP_033146481.1 | AraC family transcriptional regulator | - |
| PTC87_RS02770 (PTC87_02770) | 592856..594226 | + | 1371 | WP_033144550.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| PTC87_RS02775 (PTC87_02775) | 594273..594593 | - | 321 | WP_033144551.1 | hypothetical protein | - |
| PTC87_RS02780 (PTC87_02780) | 594593..595138 | - | 546 | WP_023310269.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11174.64 Da Isoelectric Point: 6.7609
>T272161 WP_010427219.1 NZ_CP117723:590668-590955 [Enterobacter asburiae]
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERSRYEHG
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4R0G892 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A411GC49 |