Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 529552..530236 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | PTC87_RS02480 | Protein ID | WP_137397155.1 |
| Coordinates | 529895..530236 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | PTC87_RS02475 | Protein ID | WP_137397156.1 |
| Coordinates | 529552..529869 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS02435 (PTC87_02435) | 525219..526040 | + | 822 | WP_273922651.1 | DUF932 domain-containing protein | - |
| PTC87_RS02440 (PTC87_02440) | 526259..526960 | + | 702 | WP_273922653.1 | WYL domain-containing protein | - |
| PTC87_RS02445 (PTC87_02445) | 527001..527237 | + | 237 | WP_042015432.1 | protein YpjK | - |
| PTC87_RS02450 (PTC87_02450) | 527237..527680 | + | 444 | WP_137397160.1 | hypothetical protein | - |
| PTC87_RS02455 (PTC87_02455) | 527704..528171 | + | 468 | WP_273922657.1 | protein YfjT | - |
| PTC87_RS02460 (PTC87_02460) | 528248..528487 | + | 240 | WP_137397159.1 | DUF905 domain-containing protein | - |
| PTC87_RS02465 (PTC87_02465) | 528584..529033 | + | 450 | WP_137397158.1 | antirestriction protein | - |
| PTC87_RS02470 (PTC87_02470) | 529041..529523 | + | 483 | WP_137397157.1 | DNA repair protein RadC | - |
| PTC87_RS02475 (PTC87_02475) | 529552..529869 | + | 318 | WP_137397156.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PTC87_RS02480 (PTC87_02480) | 529895..530236 | + | 342 | WP_137397155.1 | TA system toxin CbtA family protein | Toxin |
| PTC87_RS02485 (PTC87_02485) | 531004..531900 | + | 897 | Protein_481 | class I SAM-dependent DNA methyltransferase | - |
| PTC87_RS02490 (PTC87_02490) | 531972..533092 | + | 1121 | WP_085950818.1 | IS3-like element ISSen4 family transposase | - |
| PTC87_RS02495 (PTC87_02495) | 533121..534245 | + | 1125 | Protein_483 | N-6 DNA methylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 522514..542329 | 19815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12872.90 Da Isoelectric Point: 8.0800
>T272160 WP_137397155.1 NZ_CP117723:529895-530236 [Enterobacter asburiae]
MKTLPAITQRAAKPCPPPVVVWQTLLARLLDQHYGLTLNDTPFSDEIVIQEHIEAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARHATGLLRHSRNNMAI
MKTLPAITQRAAKPCPPPVVVWQTLLARLLDQHYGLTLNDTPFSDEIVIQEHIEAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARHATGLLRHSRNNMAI
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|