Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 471180..471696 | Replicon | chromosome |
Accession | NZ_CP117723 | ||
Organism | Enterobacter asburiae strain 2022CK-00757 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A7W2VUY1 |
Locus tag | PTC87_RS02210 | Protein ID | WP_033144499.1 |
Coordinates | 471412..471696 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V3EXX3 |
Locus tag | PTC87_RS02205 | Protein ID | WP_008501400.1 |
Coordinates | 471180..471422 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC87_RS02190 (PTC87_02190) | 467181..467921 | + | 741 | WP_033144496.1 | KDGP aldolase family protein | - |
PTC87_RS02195 (PTC87_02195) | 468036..469172 | + | 1137 | WP_033144497.1 | lactonase family protein | - |
PTC87_RS02200 (PTC87_02200) | 469192..471102 | + | 1911 | WP_033144498.1 | PRD domain-containing protein | - |
PTC87_RS02205 (PTC87_02205) | 471180..471422 | + | 243 | WP_008501400.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PTC87_RS02210 (PTC87_02210) | 471412..471696 | + | 285 | WP_033144499.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTC87_RS02215 (PTC87_02215) | 471700..472164 | - | 465 | WP_033144500.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PTC87_RS02220 (PTC87_02220) | 472306..474444 | - | 2139 | WP_032662478.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PTC87_RS02225 (PTC87_02225) | 474821..476464 | - | 1644 | WP_033144501.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.3350
>T272159 WP_033144499.1 NZ_CP117723:471412-471696 [Enterobacter asburiae]
MTYELAFDPRALKEWSKLGQTVKDQFKKKLADVLVSPRVESARLHGLPDCYKIKLRSQGYRLVYQVQDNVVTVFVIAIGK
REKSAVYHDANKRL
MTYELAFDPRALKEWSKLGQTVKDQFKKKLADVLVSPRVESARLHGLPDCYKIKLRSQGYRLVYQVQDNVVTVFVIAIGK
REKSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W2VUY1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3EXX3 |