Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 350754..351280 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | PTC87_RS01610 | Protein ID | WP_000323025.1 |
| Coordinates | 350754..351041 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | PTC87_RS01615 | Protein ID | WP_000534858.1 |
| Coordinates | 351041..351280 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS01590 (PTC87_01590) | 345956..347914 | - | 1959 | WP_033144420.1 | acetate--CoA ligase | - |
| PTC87_RS01595 (PTC87_01595) | 348338..349651 | + | 1314 | WP_023310067.1 | glutamate/aspartate:proton symporter GltP | - |
| PTC87_RS01600 (PTC87_01600) | 349735..350409 | - | 675 | WP_033144421.1 | tetratricopeptide repeat protein | - |
| PTC87_RS01605 (PTC87_01605) | 350531..350683 | - | 153 | WP_032644722.1 | Hok/Gef family protein | - |
| PTC87_RS01610 (PTC87_01610) | 350754..351041 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| PTC87_RS01615 (PTC87_01615) | 351041..351280 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PTC87_RS01620 (PTC87_01620) | 351305..351610 | + | 306 | WP_001326990.1 | protein YdfV | - |
| PTC87_RS01625 (PTC87_01625) | 351813..352145 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
| PTC87_RS01630 (PTC87_01630) | 352582..353922 | - | 1341 | WP_004196353.1 | IS1202-like element ISEsa1 family transposase | - |
| PTC87_RS01635 (PTC87_01635) | 354200..355135 | - | 936 | WP_016538183.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T272158 WP_000323025.1 NZ_CP117723:c351041-350754 [Enterobacter asburiae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|