Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 256847..257439 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PTC87_RS01150 | Protein ID | WP_033144376.1 |
| Coordinates | 257137..257439 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A808IFF3 |
| Locus tag | PTC87_RS01145 | Protein ID | WP_033144375.1 |
| Coordinates | 256847..257134 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS01140 (PTC87_01140) | 255219..256850 | + | 1632 | WP_033144374.1 | Na/Pi cotransporter family protein | - |
| PTC87_RS01145 (PTC87_01145) | 256847..257134 | - | 288 | WP_033144375.1 | putative addiction module antidote protein | Antitoxin |
| PTC87_RS01150 (PTC87_01150) | 257137..257439 | - | 303 | WP_033144376.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTC87_RS01155 (PTC87_01155) | 257637..258509 | + | 873 | WP_033144377.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| PTC87_RS01160 (PTC87_01160) | 258510..258782 | - | 273 | WP_023309994.1 | DUF3811 domain-containing protein | - |
| PTC87_RS01165 (PTC87_01165) | 258833..259777 | - | 945 | WP_033144378.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| PTC87_RS01170 (PTC87_01170) | 259871..261220 | - | 1350 | WP_033144379.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11284.02 Da Isoelectric Point: 9.9325
>T272157 WP_033144376.1 NZ_CP117723:c257439-257137 [Enterobacter asburiae]
MKEIVQTESFQRWEQNLKDRRAKTIIASRLFRLANGLAGDIKPVGEGISELRIHYGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNPNGRSE
MKEIVQTESFQRWEQNLKDRRAKTIIASRLFRLANGLAGDIKPVGEGISELRIHYGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNPNGRSE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|