Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 68069..68712 Replicon plasmid pB1W1
Accession NZ_CP117722
Organism Escherichia coli strain B1W1

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag PTA75_RS24555 Protein ID WP_001044768.1
Coordinates 68069..68485 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag PTA75_RS24560 Protein ID WP_001261287.1
Coordinates 68482..68712 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTA75_RS24530 (63226) 63226..63930 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
PTA75_RS24535 (64000) 64000..64473 - 474 WP_004201280.1 trimethoprim-resistant dihydrofolate reductase DfrA14 -
PTA75_RS24540 (64629) 64629..65642 + 1014 WP_000845048.1 class 1 integron integrase IntI1 -
PTA75_RS24545 (66090) 66090..66795 - 706 Protein_91 IS6-like element IS26 family transposase -
PTA75_RS24550 (66858) 66858..67907 + 1050 Protein_92 AAA family ATPase -
PTA75_RS24555 (68069) 68069..68485 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
PTA75_RS24560 (68482) 68482..68712 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PTA75_RS24565 (69008) 69008..69298 + 291 WP_000111771.1 hypothetical protein -
PTA75_RS24570 (69288) 69288..70187 + 900 WP_000963206.1 nucleotide-binding protein -
PTA75_RS24575 (70237) 70237..72462 - 2226 WP_000698737.1 P-loop NTPase fold protein -
PTA75_RS24580 (72464) 72464..73552 - 1089 WP_000952217.1 transcriptional repressor PifC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid lnu(F) / aadA22 / tet(A) / aph(3')-Ia / blaCTX-M-55 / aac(3)-IIa / floR / ant(3'')-Ia / sul3 / dfrA14 / sitABCD iucA / iucB / iucC / iucD / iutA 1..108673 108673


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T272155 WP_001044768.1 NZ_CP117722:c68485-68069 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT272155 WP_001261287.1 NZ_CP117722:c68712-68482 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References