Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 67338..67939 Replicon plasmid pB1W1-p1
Accession NZ_CP117721
Organism Escherichia coli strain B1W1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PTA75_RS23870 Protein ID WP_001216034.1
Coordinates 67338..67718 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PTA75_RS23875 Protein ID WP_001190712.1
Coordinates 67718..67939 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTA75_RS23845 (PTA75_23845) 62779..64263 - 1485 WP_032163774.1 hypothetical protein -
PTA75_RS23850 (PTA75_23850) 64263..65456 - 1194 WP_032153803.1 hypothetical protein -
PTA75_RS23855 (PTA75_23855) 65542..65994 - 453 WP_001326849.1 late promoter-activating protein -
PTA75_RS23860 (PTA75_23860) 66083..67126 - 1044 WP_009446825.1 DUF968 domain-containing protein -
PTA75_RS23865 (PTA75_23865) 67154..67333 - 180 WP_009446826.1 hypothetical protein -
PTA75_RS23870 (PTA75_23870) 67338..67718 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PTA75_RS23875 (PTA75_23875) 67718..67939 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PTA75_RS23880 (PTA75_23880) 68012..68401 - 390 WP_000506730.1 S24 family peptidase -
PTA75_RS23885 (PTA75_23885) 68576..69160 + 585 WP_032272826.1 hypothetical protein -
PTA75_RS23890 (PTA75_23890) 69161..69517 + 357 WP_032272825.1 hypothetical protein -
PTA75_RS23895 (PTA75_23895) 70593..70955 - 363 WP_009447741.1 hypothetical protein -
PTA75_RS23900 (PTA75_23900) 71798..71905 - 108 Protein_75 hypothetical protein -
PTA75_RS23905 (PTA75_23905) 72116..72250 - 135 Protein_76 hypothetical protein -
PTA75_RS23910 (PTA75_23910) 72247..72579 - 333 WP_123007567.1 hypothetical protein -
PTA75_RS23915 (PTA75_23915) 72584..72762 - 179 Protein_78 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..97576 97576


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T272148 WP_001216034.1 NZ_CP117721:c67718-67338 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT272148 WP_001190712.1 NZ_CP117721:c67939-67718 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References