Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2884034..2884874 | Replicon | chromosome |
| Accession | NZ_CP117720 | ||
| Organism | Escherichia coli strain B1W1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B1LJY4 |
| Locus tag | PTA75_RS14180 | Protein ID | WP_000854686.1 |
| Coordinates | 2884034..2884417 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M0YJ34 |
| Locus tag | PTA75_RS14185 | Protein ID | WP_001360163.1 |
| Coordinates | 2884494..2884874 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA75_RS14140 (2879036) | 2879036..2879527 | - | 492 | WP_001297187.1 | DUF1097 domain-containing protein | - |
| PTA75_RS14145 (2879629) | 2879629..2880183 | - | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
| PTA75_RS14150 (2880207) | 2880207..2880944 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| PTA75_RS14155 (2880999) | 2880999..2881937 | - | 939 | WP_000351311.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| PTA75_RS14165 (2882408) | 2882408..2883250 | - | 843 | WP_001274547.1 | DUF4942 domain-containing protein | - |
| PTA75_RS14170 (2883335) | 2883335..2883532 | - | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
| PTA75_RS14175 (2883549) | 2883549..2884037 | - | 489 | WP_001054233.1 | DUF5983 family protein | - |
| PTA75_RS14180 (2884034) | 2884034..2884417 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
| PTA75_RS14185 (2884494) | 2884494..2884874 | - | 381 | WP_001360163.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PTA75_RS14190 (2884885) | 2884885..2885382 | - | 498 | Protein_2779 | antitoxin of toxin-antitoxin stability system | - |
| PTA75_RS14195 (2885383) | 2885383..2885640 | + | 258 | Protein_2780 | JAB domain-containing protein | - |
| PTA75_RS14200 (2885703) | 2885703..2885924 | + | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
| PTA75_RS14205 (2885943) | 2885943..2886131 | + | 189 | Protein_2782 | antitoxin of toxin-antitoxin stability system | - |
| PTA75_RS14210 (2886126) | 2886126..2886347 | - | 222 | Protein_2783 | hypothetical protein | - |
| PTA75_RS14215 (2886363) | 2886363..2886848 | - | 486 | WP_000214307.1 | antirestriction protein | - |
| PTA75_RS14220 (2886940) | 2886940..2887756 | - | 817 | Protein_2785 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgB / csgD / csgE / csgF / csgG / wbbO / wbbN / glf / wbbM / wzt / wzm | 2875418..2928753 | 53335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T272144 WP_000854686.1 NZ_CP117720:c2884417-2884034 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13950.74 Da Isoelectric Point: 5.0823
>AT272144 WP_001360163.1 NZ_CP117720:c2884874-2884494 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCIVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCIVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|