Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2884034..2884874 Replicon chromosome
Accession NZ_CP117720
Organism Escherichia coli strain B1W1

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag PTA75_RS14180 Protein ID WP_000854686.1
Coordinates 2884034..2884417 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M0YJ34
Locus tag PTA75_RS14185 Protein ID WP_001360163.1
Coordinates 2884494..2884874 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTA75_RS14140 (2879036) 2879036..2879527 - 492 WP_001297187.1 DUF1097 domain-containing protein -
PTA75_RS14145 (2879629) 2879629..2880183 - 555 WP_001001902.1 molecular chaperone YcdY -
PTA75_RS14150 (2880207) 2880207..2880944 - 738 WP_000283664.1 zinc-binding phosphatase -
PTA75_RS14155 (2880999) 2880999..2881937 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
PTA75_RS14165 (2882408) 2882408..2883250 - 843 WP_001274547.1 DUF4942 domain-containing protein -
PTA75_RS14170 (2883335) 2883335..2883532 - 198 WP_000839253.1 DUF957 domain-containing protein -
PTA75_RS14175 (2883549) 2883549..2884037 - 489 WP_001054233.1 DUF5983 family protein -
PTA75_RS14180 (2884034) 2884034..2884417 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
PTA75_RS14185 (2884494) 2884494..2884874 - 381 WP_001360163.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PTA75_RS14190 (2884885) 2884885..2885382 - 498 Protein_2779 antitoxin of toxin-antitoxin stability system -
PTA75_RS14195 (2885383) 2885383..2885640 + 258 Protein_2780 JAB domain-containing protein -
PTA75_RS14200 (2885703) 2885703..2885924 + 222 WP_000692298.1 DUF987 domain-containing protein -
PTA75_RS14205 (2885943) 2885943..2886131 + 189 Protein_2782 antitoxin of toxin-antitoxin stability system -
PTA75_RS14210 (2886126) 2886126..2886347 - 222 Protein_2783 hypothetical protein -
PTA75_RS14215 (2886363) 2886363..2886848 - 486 WP_000214307.1 antirestriction protein -
PTA75_RS14220 (2886940) 2886940..2887756 - 817 Protein_2785 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG / wbbO / wbbN / glf / wbbM / wzt / wzm 2875418..2928753 53335


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T272144 WP_000854686.1 NZ_CP117720:c2884417-2884034 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13950.74 Da        Isoelectric Point: 5.0823

>AT272144 WP_001360163.1 NZ_CP117720:c2884874-2884494 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCIVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0YJ34

References