Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1361218..1361843 | Replicon | chromosome |
| Accession | NZ_CP117720 | ||
| Organism | Escherichia coli strain B1W1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PTA75_RS06660 | Protein ID | WP_000911330.1 |
| Coordinates | 1361445..1361843 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | PTA75_RS06655 | Protein ID | WP_000450524.1 |
| Coordinates | 1361218..1361445 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA75_RS06630 (1357021) | 1357021..1357491 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| PTA75_RS06635 (1357491) | 1357491..1358063 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| PTA75_RS06640 (1358209) | 1358209..1359087 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| PTA75_RS06645 (1359104) | 1359104..1360138 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| PTA75_RS06650 (1360351) | 1360351..1361064 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| PTA75_RS06655 (1361218) | 1361218..1361445 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PTA75_RS06660 (1361445) | 1361445..1361843 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PTA75_RS06665 (1361990) | 1361990..1362853 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| PTA75_RS06670 (1362868) | 1362868..1364883 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| PTA75_RS06675 (1364957) | 1364957..1365655 | + | 699 | WP_000679823.1 | esterase | - |
| PTA75_RS06680 (1365765) | 1365765..1365965 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T272138 WP_000911330.1 NZ_CP117720:1361445-1361843 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|