Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 919465..920119 | Replicon | chromosome |
| Accession | NZ_CP117720 | ||
| Organism | Escherichia coli strain B1W1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | PTA75_RS04545 | Protein ID | WP_000244777.1 |
| Coordinates | 919712..920119 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PTA75_RS04540 | Protein ID | WP_000354046.1 |
| Coordinates | 919465..919731 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA75_RS04515 (914753) | 914753..915496 | + | 744 | Protein_886 | SDR family oxidoreductase | - |
| PTA75_RS04520 (915553) | 915553..916986 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| PTA75_RS04525 (917031) | 917031..917342 | + | 312 | WP_001679467.1 | N(4)-acetylcytidine aminohydrolase | - |
| PTA75_RS04530 (917506) | 917506..918165 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PTA75_RS04535 (918242) | 918242..919222 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| PTA75_RS04540 (919465) | 919465..919731 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PTA75_RS04545 (919712) | 919712..920119 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| PTA75_RS04550 (920159) | 920159..920680 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PTA75_RS04555 (920792) | 920792..921688 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PTA75_RS04560 (921713) | 921713..922423 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PTA75_RS04565 (922429) | 922429..924162 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T272135 WP_000244777.1 NZ_CP117720:919712-920119 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |