Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 803392..804227 | Replicon | chromosome |
| Accession | NZ_CP117720 | ||
| Organism | Escherichia coli strain B1W1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7A2ZCB4 |
| Locus tag | PTA75_RS03910 | Protein ID | WP_061157978.1 |
| Coordinates | 803392..803769 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | PTA75_RS03915 | Protein ID | WP_001285610.1 |
| Coordinates | 803859..804227 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA75_RS03875 (798869) | 798869..799072 | + | 204 | Protein_760 | type II secretion system protein GspJ | - |
| PTA75_RS03880 (799075) | 799075..800052 | + | 978 | WP_000633220.1 | type II secretion system minor pseudopilin GspK | - |
| PTA75_RS03885 (800049) | 800049..801227 | + | 1179 | WP_000094970.1 | type II secretion system protein GspL | - |
| PTA75_RS03890 (801229) | 801229..801765 | + | 537 | WP_000942786.1 | GspM family type II secretion system protein YghD | - |
| PTA75_RS03895 (802046) | 802046..802888 | - | 843 | WP_001280493.1 | DUF4942 domain-containing protein | - |
| PTA75_RS03900 (802973) | 802973..803170 | - | 198 | WP_085949090.1 | DUF957 domain-containing protein | - |
| PTA75_RS03905 (803198) | 803198..803395 | - | 198 | Protein_766 | DUF5983 family protein | - |
| PTA75_RS03910 (803392) | 803392..803769 | - | 378 | WP_061157978.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PTA75_RS03915 (803859) | 803859..804227 | - | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PTA75_RS03920 (804307) | 804307..804528 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| PTA75_RS03925 (804615) | 804615..805091 | - | 477 | WP_123005181.1 | RadC family protein | - |
| PTA75_RS03930 (805107) | 805107..805277 | - | 171 | Protein_771 | antirestriction protein | - |
| PTA75_RS03935 (805279) | 805279..807099 | - | 1821 | Protein_772 | AIDA repeat-containing protein | - |
| PTA75_RS03940 (807471) | 807471..808343 | - | 873 | WP_021527212.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13911.90 Da Isoelectric Point: 7.9085
>T272134 WP_061157978.1 NZ_CP117720:c803769-803392 [Escherichia coli]
MKTLPVLPGQAASSHPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSHPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT272134 WP_001285610.1 NZ_CP117720:c804227-803859 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|