Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3672717..3673554 | Replicon | chromosome |
| Accession | NZ_CP117717 | ||
| Organism | Escherichia coli strain B1S11 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | PTA69_RS18015 | Protein ID | WP_000227784.1 |
| Coordinates | 3673012..3673554 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | PTA69_RS18010 | Protein ID | WP_001297137.1 |
| Coordinates | 3672717..3673028 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA69_RS17985 (3667737) | 3667737..3668684 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| PTA69_RS17990 (3668706) | 3668706..3670697 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| PTA69_RS17995 (3670687) | 3670687..3671301 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| PTA69_RS18000 (3671301) | 3671301..3671630 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| PTA69_RS18005 (3671642) | 3671642..3672532 | + | 891 | WP_000971336.1 | heme o synthase | - |
| PTA69_RS18010 (3672717) | 3672717..3673028 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| PTA69_RS18015 (3673012) | 3673012..3673554 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| PTA69_RS18020 (3673610) | 3673610..3674545 | - | 936 | WP_001368479.1 | tetratricopeptide repeat protein | - |
| PTA69_RS18025 (3674953) | 3674953..3676317 | + | 1365 | WP_001000960.1 | MFS transporter | - |
| PTA69_RS18030 (3676445) | 3676445..3676936 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| PTA69_RS18035 (3677104) | 3677104..3678015 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T272118 WP_000227784.1 NZ_CP117717:3673012-3673554 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|