Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3638640..3639258 | Replicon | chromosome |
Accession | NZ_CP117717 | ||
Organism | Escherichia coli strain B1S11 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | PTA69_RS17845 | Protein ID | WP_062874123.1 |
Coordinates | 3639040..3639258 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PTA69_RS17840 | Protein ID | WP_000344800.1 |
Coordinates | 3638640..3639014 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA69_RS17830 (3633729) | 3633729..3634922 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PTA69_RS17835 (3634945) | 3634945..3638094 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PTA69_RS17840 (3638640) | 3638640..3639014 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PTA69_RS17845 (3639040) | 3639040..3639258 | + | 219 | WP_062874123.1 | HHA domain-containing protein | Toxin |
PTA69_RS17850 (3639430) | 3639430..3639981 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PTA69_RS17855 (3640097) | 3640097..3640567 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PTA69_RS17860 (3640731) | 3640731..3642281 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PTA69_RS17865 (3642323) | 3642323..3642676 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
PTA69_RS17875 (3643055) | 3643055..3643366 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PTA69_RS17880 (3643397) | 3643397..3643969 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8704.10 Da Isoelectric Point: 8.8580
>T272117 WP_062874123.1 NZ_CP117717:3639040-3639258 [Escherichia coli]
MYEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MYEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT272117 WP_000344800.1 NZ_CP117717:3638640-3639014 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|