Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1359238..1359863 | Replicon | chromosome |
Accession | NZ_CP117717 | ||
Organism | Escherichia coli strain B1S11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PTA69_RS06565 | Protein ID | WP_000911330.1 |
Coordinates | 1359465..1359863 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PTA69_RS06560 | Protein ID | WP_000450524.1 |
Coordinates | 1359238..1359465 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA69_RS06535 (1355041) | 1355041..1355511 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
PTA69_RS06540 (1355511) | 1355511..1356083 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PTA69_RS06545 (1356229) | 1356229..1357107 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PTA69_RS06550 (1357124) | 1357124..1358158 | + | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
PTA69_RS06555 (1358371) | 1358371..1359084 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PTA69_RS06560 (1359238) | 1359238..1359465 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PTA69_RS06565 (1359465) | 1359465..1359863 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTA69_RS06570 (1360010) | 1360010..1360873 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
PTA69_RS06575 (1360888) | 1360888..1362903 | + | 2016 | WP_063112794.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PTA69_RS06580 (1362977) | 1362977..1363675 | + | 699 | WP_000679823.1 | esterase | - |
PTA69_RS06585 (1363785) | 1363785..1363985 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T272110 WP_000911330.1 NZ_CP117717:1359465-1359863 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|