Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 96734..97377 | Replicon | plasmid pPBS4 |
Accession | NZ_CP117716 | ||
Organism | Escherichia coli strain PBS4 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | PTA50_RS24720 | Protein ID | WP_001044768.1 |
Coordinates | 96734..97150 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | PTA50_RS24725 | Protein ID | WP_001261287.1 |
Coordinates | 97147..97377 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA50_RS24705 (93233) | 93233..93823 | - | 591 | WP_000194575.1 | hypothetical protein | - |
PTA50_RS24710 (93823) | 93823..94080 | - | 258 | WP_000343085.1 | hypothetical protein | - |
PTA50_RS24715 (94434) | 94434..96572 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
PTA50_RS24720 (96734) | 96734..97150 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTA50_RS24725 (97147) | 97147..97377 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PTA50_RS24730 (97673) | 97673..97963 | + | 291 | WP_000111771.1 | hypothetical protein | - |
PTA50_RS24735 (97953) | 97953..98852 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
PTA50_RS24740 (98902) | 98902..101127 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
PTA50_RS24745 (101129) | 101129..102217 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / floR / aph(3')-Ia / dfrA14 / blaCTX-M-55 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..137545 | 137545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T272105 WP_001044768.1 NZ_CP117716:c97150-96734 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |