Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 35157..35782 | Replicon | plasmid pPBS4 |
Accession | NZ_CP117716 | ||
Organism | Escherichia coli strain PBS4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PTA50_RS24370 | Protein ID | WP_000911313.1 |
Coordinates | 35157..35555 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | PTA50_RS24375 | Protein ID | WP_000450520.1 |
Coordinates | 35555..35782 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA50_RS24355 (31518) | 31518..32015 | + | 498 | WP_000605857.1 | entry exclusion protein | - |
PTA50_RS24360 (32047) | 32047..32778 | + | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
PTA50_RS24365 (32995) | 32995..35148 | + | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
PTA50_RS24370 (35157) | 35157..35555 | - | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTA50_RS24375 (35555) | 35555..35782 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / floR / aph(3')-Ia / dfrA14 / blaCTX-M-55 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..137545 | 137545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T272101 WP_000911313.1 NZ_CP117716:c35555-35157 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|