Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 65978..66579 Replicon plasmid pPBS4-p1
Accession NZ_CP117715
Organism Escherichia coli strain PBS4

Toxin (Protein)


Gene name doc Uniprot ID U9Z1Q0
Locus tag PTA50_RS23895 Protein ID WP_001216047.1
Coordinates 65978..66358 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PTA50_RS23900 Protein ID WP_001190712.1
Coordinates 66358..66579 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTA50_RS23870 (PTA50_23870) 61418..62902 - 1485 WP_000124150.1 terminase -
PTA50_RS23875 (PTA50_23875) 62902..64095 - 1194 WP_000219608.1 hypothetical protein -
PTA50_RS23880 (PTA50_23880) 64182..64634 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
PTA50_RS23885 (PTA50_23885) 64723..65766 - 1044 WP_000644102.1 DUF968 domain-containing protein -
PTA50_RS23890 (PTA50_23890) 65794..65973 - 180 WP_000113019.1 hypothetical protein -
PTA50_RS23895 (PTA50_23895) 65978..66358 - 381 WP_001216047.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PTA50_RS23900 (PTA50_23900) 66358..66579 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PTA50_RS23905 (PTA50_23905) 66652..67041 - 390 WP_000506730.1 S24 family peptidase -
PTA50_RS23910 (PTA50_23910) 67216..67800 + 585 WP_042198310.1 hypothetical protein -
PTA50_RS23915 (PTA50_23915) 67801..68157 + 357 WP_001062545.1 hypothetical protein -
PTA50_RS23920 (PTA50_23920) 69233..69595 - 363 WP_001261543.1 hypothetical protein -
PTA50_RS23925 (PTA50_23925) 69592..70491 - 900 WP_233403841.1 hypothetical protein -
PTA50_RS23930 (PTA50_23930) 70468..70602 - 135 Protein_67 hypothetical protein -
PTA50_RS23935 (PTA50_23935) 70936..71114 - 179 Protein_68 hypothetical protein -
PTA50_RS23940 (PTA50_23940) 71116..71304 - 189 WP_000797279.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..98022 98022


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T272097 WP_001216047.1 NZ_CP117715:c66358-65978 [Escherichia coli]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT272097 WP_001190712.1 NZ_CP117715:c66579-66358 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z1Q0

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References