Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 65978..66579 | Replicon | plasmid pPBS4-p1 |
| Accession | NZ_CP117715 | ||
| Organism | Escherichia coli strain PBS4 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9Z1Q0 |
| Locus tag | PTA50_RS23895 | Protein ID | WP_001216047.1 |
| Coordinates | 65978..66358 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | PTA50_RS23900 | Protein ID | WP_001190712.1 |
| Coordinates | 66358..66579 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA50_RS23870 (PTA50_23870) | 61418..62902 | - | 1485 | WP_000124150.1 | terminase | - |
| PTA50_RS23875 (PTA50_23875) | 62902..64095 | - | 1194 | WP_000219608.1 | hypothetical protein | - |
| PTA50_RS23880 (PTA50_23880) | 64182..64634 | - | 453 | WP_001312282.1 | late promoter-activating protein (Gp10) | - |
| PTA50_RS23885 (PTA50_23885) | 64723..65766 | - | 1044 | WP_000644102.1 | DUF968 domain-containing protein | - |
| PTA50_RS23890 (PTA50_23890) | 65794..65973 | - | 180 | WP_000113019.1 | hypothetical protein | - |
| PTA50_RS23895 (PTA50_23895) | 65978..66358 | - | 381 | WP_001216047.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PTA50_RS23900 (PTA50_23900) | 66358..66579 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PTA50_RS23905 (PTA50_23905) | 66652..67041 | - | 390 | WP_000506730.1 | S24 family peptidase | - |
| PTA50_RS23910 (PTA50_23910) | 67216..67800 | + | 585 | WP_042198310.1 | hypothetical protein | - |
| PTA50_RS23915 (PTA50_23915) | 67801..68157 | + | 357 | WP_001062545.1 | hypothetical protein | - |
| PTA50_RS23920 (PTA50_23920) | 69233..69595 | - | 363 | WP_001261543.1 | hypothetical protein | - |
| PTA50_RS23925 (PTA50_23925) | 69592..70491 | - | 900 | WP_233403841.1 | hypothetical protein | - |
| PTA50_RS23930 (PTA50_23930) | 70468..70602 | - | 135 | Protein_67 | hypothetical protein | - |
| PTA50_RS23935 (PTA50_23935) | 70936..71114 | - | 179 | Protein_68 | hypothetical protein | - |
| PTA50_RS23940 (PTA50_23940) | 71116..71304 | - | 189 | WP_000797279.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..98022 | 98022 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13574.27 Da Isoelectric Point: 5.1514
>T272097 WP_001216047.1 NZ_CP117715:c66358-65978 [Escherichia coli]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9Z1Q0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |