Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 4192983..4193758 | Replicon | chromosome |
| Accession | NZ_CP117714 | ||
| Organism | Escherichia coli strain PBS4 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A7V7JG91 |
| Locus tag | PTA50_RS20325 | Protein ID | WP_001193488.1 |
| Coordinates | 4192983..4193354 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7V7JFU6 |
| Locus tag | PTA50_RS20330 | Protein ID | WP_001059301.1 |
| Coordinates | 4193393..4193758 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA50_RS20300 (4188065) | 4188065..4189171 | + | 1107 | WP_001044128.1 | N-acetylneuraminate epimerase | - |
| PTA50_RS20305 (4189236) | 4189236..4190216 | + | 981 | WP_001366032.1 | sialate O-acetylesterase | - |
| PTA50_RS20310 (4190224) | 4190224..4190328 | - | 105 | Protein_3975 | HNH endonuclease | - |
| PTA50_RS20315 (4190428) | 4190428..4191300 | + | 873 | WP_000168567.1 | HNH endonuclease | - |
| PTA50_RS20320 (4191411) | 4191411..4192409 | - | 999 | WP_001240355.1 | membrane protein | - |
| PTA50_RS20325 (4192983) | 4192983..4193354 | - | 372 | WP_001193488.1 | TA system toxin CbtA family protein | Toxin |
| PTA50_RS20330 (4193393) | 4193393..4193758 | - | 366 | WP_001059301.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PTA50_RS20335 (4193784) | 4193784..4194005 | - | 222 | WP_000691983.1 | DUF987 domain-containing protein | - |
| PTA50_RS20340 (4194002) | 4194002..4194544 | - | 543 | WP_015740440.1 | DNA repair protein RadC | - |
| PTA50_RS20345 (4194557) | 4194557..4195000 | - | 444 | WP_001096016.1 | antirestriction protein | - |
| PTA50_RS20350 (4195031) | 4195031..4195852 | - | 822 | WP_001234409.1 | DUF932 domain-containing protein | - |
| PTA50_RS20355 (4195972) | 4195972..4196445 | - | 474 | WP_001298943.1 | hypothetical protein | - |
| PTA50_RS20360 (4196517) | 4196517..4196969 | - | 453 | WP_000734321.1 | hypothetical protein | - |
| PTA50_RS20365 (4197005) | 4197005..4197721 | - | 717 | WP_000174910.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4185272..4200498 | 15226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13832.94 Da Isoelectric Point: 7.2419
>T272093 WP_001193488.1 NZ_CP117714:c4193354-4192983 [Escherichia coli]
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYELVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYELVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL
Download Length: 372 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13388.25 Da Isoelectric Point: 5.9530
>AT272093 WP_001059301.1 NZ_CP117714:c4193758-4193393 [Escherichia coli]
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7JG91 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7JFU6 |