Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3556654..3557491 | Replicon | chromosome |
Accession | NZ_CP117714 | ||
Organism | Escherichia coli strain PBS4 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | PTA50_RS17240 | Protein ID | WP_000227784.1 |
Coordinates | 3556949..3557491 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | PTA50_RS17235 | Protein ID | WP_001297137.1 |
Coordinates | 3556654..3556965 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA50_RS17210 (3551674) | 3551674..3552621 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
PTA50_RS17215 (3552643) | 3552643..3554634 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
PTA50_RS17220 (3554624) | 3554624..3555238 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PTA50_RS17225 (3555238) | 3555238..3555567 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PTA50_RS17230 (3555579) | 3555579..3556469 | + | 891 | WP_000971336.1 | heme o synthase | - |
PTA50_RS17235 (3556654) | 3556654..3556965 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
PTA50_RS17240 (3556949) | 3556949..3557491 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
PTA50_RS17245 (3557547) | 3557547..3558482 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
PTA50_RS17250 (3558890) | 3558890..3560254 | + | 1365 | WP_001000975.1 | MFS transporter | - |
PTA50_RS17255 (3560382) | 3560382..3560873 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
PTA50_RS17260 (3561041) | 3561041..3561952 | + | 912 | WP_000705877.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T272091 WP_000227784.1 NZ_CP117714:3556949-3557491 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|