Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3522565..3523183 | Replicon | chromosome |
Accession | NZ_CP117714 | ||
Organism | Escherichia coli strain PBS4 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PTA50_RS17070 | Protein ID | WP_001291435.1 |
Coordinates | 3522965..3523183 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PTA50_RS17065 | Protein ID | WP_000344800.1 |
Coordinates | 3522565..3522939 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA50_RS17055 (3517654) | 3517654..3518847 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PTA50_RS17060 (3518870) | 3518870..3522019 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PTA50_RS17065 (3522565) | 3522565..3522939 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PTA50_RS17070 (3522965) | 3522965..3523183 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PTA50_RS17075 (3523354) | 3523354..3523905 | + | 552 | WP_000102578.1 | maltose O-acetyltransferase | - |
PTA50_RS17080 (3524021) | 3524021..3524491 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PTA50_RS17085 (3524655) | 3524655..3526205 | + | 1551 | WP_001365886.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PTA50_RS17090 (3526247) | 3526247..3526600 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PTA50_RS17100 (3526979) | 3526979..3527290 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PTA50_RS17105 (3527321) | 3527321..3527893 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T272090 WP_001291435.1 NZ_CP117714:3522965-3523183 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT272090 WP_000344800.1 NZ_CP117714:3522565-3522939 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |