Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1348450..1349075 | Replicon | chromosome |
Accession | NZ_CP117714 | ||
Organism | Escherichia coli strain PBS4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | PTA50_RS06555 | Protein ID | WP_000911329.1 |
Coordinates | 1348677..1349075 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PTA50_RS06550 | Protein ID | WP_000450524.1 |
Coordinates | 1348450..1348677 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA50_RS06525 (1344252) | 1344252..1344722 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
PTA50_RS06530 (1344722) | 1344722..1345294 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PTA50_RS06535 (1345440) | 1345440..1346318 | + | 879 | WP_001311023.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PTA50_RS06540 (1346335) | 1346335..1347369 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PTA50_RS06545 (1347582) | 1347582..1348295 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PTA50_RS06550 (1348450) | 1348450..1348677 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PTA50_RS06555 (1348677) | 1348677..1349075 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTA50_RS06560 (1349222) | 1349222..1350085 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
PTA50_RS06565 (1350100) | 1350100..1352115 | + | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PTA50_RS06570 (1352189) | 1352189..1352887 | + | 699 | WP_000679823.1 | esterase | - |
PTA50_RS06575 (1352997) | 1352997..1353197 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T272083 WP_000911329.1 NZ_CP117714:1348677-1349075 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |