Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 5344799..5345324 | Replicon | chromosome |
Accession | NZ_CP117709 | ||
Organism | Streptomyces sp. MMBL 11-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PSQ21_RS23975 | Protein ID | WP_274032866.1 |
Coordinates | 5344799..5345062 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PSQ21_RS23980 | Protein ID | WP_274032867.1 |
Coordinates | 5345055..5345324 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSQ21_RS23950 | 5339885..5340640 | + | 756 | WP_274032856.1 | ROK family protein | - |
PSQ21_RS23955 | 5340754..5341413 | - | 660 | WP_274032858.1 | hypothetical protein | - |
PSQ21_RS23960 | 5341704..5342792 | + | 1089 | WP_274032860.1 | redox-regulated ATPase YchF | - |
PSQ21_RS23965 | 5343319..5343570 | + | 252 | WP_148020499.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PSQ21_RS23970 | 5343567..5343983 | + | 417 | WP_274032864.1 | PIN domain nuclease | - |
PSQ21_RS23975 | 5344799..5345062 | - | 264 | WP_274032866.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PSQ21_RS23980 | 5345055..5345324 | - | 270 | WP_274032867.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PSQ21_RS23985 | 5345705..5347450 | + | 1746 | WP_274032870.1 | class I SAM-dependent DNA methyltransferase | - |
PSQ21_RS23990 | 5347447..5348682 | + | 1236 | WP_274032871.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10057.47 Da Isoelectric Point: 7.2015
>T272076 WP_274032866.1 NZ_CP117709:c5345062-5344799 [Streptomyces sp. MMBL 11-1]
VSEYRTVFRPEAQAELRKVPRDMALRILAKLTELESDPLGFNTTALVSQPDRRRLRVGDYRVIYTIDDGELVVWVVHVGH
RSTVYDT
VSEYRTVFRPEAQAELRKVPRDMALRILAKLTELESDPLGFNTTALVSQPDRRRLRVGDYRVIYTIDDGELVVWVVHVGH
RSTVYDT
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|