Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2345810..2346374 | Replicon | chromosome |
Accession | NZ_CP117709 | ||
Organism | Streptomyces sp. MMBL 11-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PSQ21_RS10085 | Protein ID | WP_274030100.1 |
Coordinates | 2345810..2346133 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PSQ21_RS10090 | Protein ID | WP_274030101.1 |
Coordinates | 2346150..2346374 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSQ21_RS10075 | 2341121..2344423 | + | 3303 | WP_274030099.1 | S8 family serine peptidase | - |
PSQ21_RS10080 | 2344711..2345739 | + | 1029 | WP_274035698.1 | aspartate-semialdehyde dehydrogenase | - |
PSQ21_RS10085 | 2345810..2346133 | - | 324 | WP_274030100.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PSQ21_RS10090 | 2346150..2346374 | - | 225 | WP_274030101.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PSQ21_RS10095 | 2346478..2349054 | + | 2577 | WP_274030102.1 | aminopeptidase N | - |
PSQ21_RS10100 | 2349268..2349801 | + | 534 | WP_274030103.1 | hypothetical protein | - |
PSQ21_RS10105 | 2349897..2351051 | - | 1155 | WP_274030104.1 | allantoicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11692.52 Da Isoelectric Point: 11.3764
>T272074 WP_274030100.1 NZ_CP117709:c2346133-2345810 [Streptomyces sp. MMBL 11-1]
VDLEPARGSEANKVRPAVIVSNNAANRSVELTGRGVVAVVPLTSNTSRVLSFQVLLAAKESQLPQNSKVQCEQIRAVFPD
RVLKRIGEVPRQRMAEIDAALRRHLAL
VDLEPARGSEANKVRPAVIVSNNAANRSVELTGRGVVAVVPLTSNTSRVLSFQVLLAAKESQLPQNSKVQCEQIRAVFPD
RVLKRIGEVPRQRMAEIDAALRRHLAL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|