Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4185454..4186235 | Replicon | chromosome |
Accession | NZ_CP117698 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain L1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A5I1HVL4 |
Locus tag | PRJ38_RS20285 | Protein ID | WP_023255089.1 |
Coordinates | 4185454..4185945 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | PRJ38_RS20290 | Protein ID | WP_001271379.1 |
Coordinates | 4185942..4186235 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRJ38_RS20260 (4182335) | 4182335..4183165 | - | 831 | WP_079948288.1 | fimbria/pilus periplasmic chaperone | - |
PRJ38_RS20265 (4183367) | 4183367..4183672 | - | 306 | WP_000370555.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PRJ38_RS20270 (4184204) | 4184204..4184347 | + | 144 | Protein_3969 | transposase | - |
PRJ38_RS20275 (4184364) | 4184364..4184710 | + | 347 | Protein_3970 | Rpn family recombination-promoting nuclease/putative transposase | - |
PRJ38_RS20280 (4184991) | 4184991..4185239 | - | 249 | Protein_3971 | IS481 family transposase | - |
PRJ38_RS20285 (4185454) | 4185454..4185945 | - | 492 | WP_023255089.1 | GNAT family N-acetyltransferase | Toxin |
PRJ38_RS20290 (4185942) | 4185942..4186235 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
PRJ38_RS20295 (4186553) | 4186553..4186775 | + | 223 | Protein_3974 | hypothetical protein | - |
PRJ38_RS20300 (4187041) | 4187041..4187916 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
PRJ38_RS20305 (4187913) | 4187913..4188200 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PRJ38_RS20310 (4188223) | 4188223..4188437 | + | 215 | Protein_3977 | hypothetical protein | - |
PRJ38_RS20315 (4188445) | 4188445..4188588 | + | 144 | Protein_3978 | hypothetical protein | - |
PRJ38_RS20320 (4188700) | 4188700..4188789 | + | 90 | Protein_3979 | hypothetical protein | - |
PRJ38_RS20325 (4189078) | 4189078..4189983 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4174847..4189938 | 15091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17633.45 Da Isoelectric Point: 7.7297
>T272071 WP_023255089.1 NZ_CP117698:c4185945-4185454 [Salmonella enterica subsp. enterica serovar London]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT272071 WP_001271379.1 NZ_CP117698:c4186235-4185942 [Salmonella enterica subsp. enterica serovar London]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1HVL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |