Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4186610..4187391 | Replicon | chromosome |
Accession | NZ_CP117696 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain F1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A5I1HVL4 |
Locus tag | PTQ22_RS20290 | Protein ID | WP_023255089.1 |
Coordinates | 4186610..4187101 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | PTQ22_RS20295 | Protein ID | WP_001271379.1 |
Coordinates | 4187098..4187391 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ22_RS20265 (4183491) | 4183491..4184321 | - | 831 | WP_079948288.1 | fimbria/pilus periplasmic chaperone | - |
PTQ22_RS20270 (4184523) | 4184523..4184828 | - | 306 | WP_000370555.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PTQ22_RS20275 (4185360) | 4185360..4185503 | + | 144 | Protein_3970 | transposase | - |
PTQ22_RS20280 (4185520) | 4185520..4185866 | + | 347 | Protein_3971 | Rpn family recombination-promoting nuclease/putative transposase | - |
PTQ22_RS20285 (4186147) | 4186147..4186395 | - | 249 | Protein_3972 | IS481 family transposase | - |
PTQ22_RS20290 (4186610) | 4186610..4187101 | - | 492 | WP_023255089.1 | GNAT family N-acetyltransferase | Toxin |
PTQ22_RS20295 (4187098) | 4187098..4187391 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
PTQ22_RS20300 (4187709) | 4187709..4187931 | + | 223 | Protein_3975 | hypothetical protein | - |
PTQ22_RS20305 (4188197) | 4188197..4189072 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
PTQ22_RS20310 (4189069) | 4189069..4189356 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PTQ22_RS20315 (4189379) | 4189379..4189593 | + | 215 | Protein_3978 | hypothetical protein | - |
PTQ22_RS20320 (4189601) | 4189601..4189744 | + | 144 | Protein_3979 | hypothetical protein | - |
PTQ22_RS20325 (4189856) | 4189856..4189945 | + | 90 | Protein_3980 | hypothetical protein | - |
PTQ22_RS20330 (4190234) | 4190234..4191139 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4176003..4189945 | 13942 | |
- | inside | Genomic island | - | - | 4176003..4189356 | 13353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17633.45 Da Isoelectric Point: 7.7297
>T272054 WP_023255089.1 NZ_CP117696:c4187101-4186610 [Salmonella enterica subsp. enterica serovar London]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT272054 WP_001271379.1 NZ_CP117696:c4187391-4187098 [Salmonella enterica subsp. enterica serovar London]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1HVL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |