Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4072029..4072545 | Replicon | chromosome |
Accession | NZ_CP117696 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain F1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5I6CHB9 |
Locus tag | PTQ22_RS19660 | Protein ID | WP_000220581.1 |
Coordinates | 4072029..4072313 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PTQ22_RS19665 | Protein ID | WP_000212724.1 |
Coordinates | 4072303..4072545 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ22_RS19645 (4067241) | 4067241..4068893 | + | 1653 | WP_023257400.1 | alpha,alpha-phosphotrehalase | - |
PTQ22_RS19650 (4069302) | 4069302..4071440 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PTQ22_RS19655 (4071561) | 4071561..4072025 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PTQ22_RS19660 (4072029) | 4072029..4072313 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTQ22_RS19665 (4072303) | 4072303..4072545 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PTQ22_RS19670 (4072623) | 4072623..4074536 | - | 1914 | WP_001212148.1 | BglG family transcription antiterminator | - |
PTQ22_RS19675 (4074553) | 4074553..4075293 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
PTQ22_RS19680 (4075290) | 4075290..4076408 | - | 1119 | WP_023256352.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PTQ22_RS19685 (4076392) | 4076392..4077525 | - | 1134 | WP_023257225.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T272053 WP_000220581.1 NZ_CP117696:c4072313-4072029 [Salmonella enterica subsp. enterica serovar London]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I6CHB9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |