Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 3986880..3987456 | Replicon | chromosome |
Accession | NZ_CP117696 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain F1 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | PTQ22_RS19275 | Protein ID | WP_001131963.1 |
Coordinates | 3987169..3987456 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A5J0SGD3 |
Locus tag | PTQ22_RS19270 | Protein ID | WP_023254955.1 |
Coordinates | 3986880..3987182 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ22_RS19255 (3983390) | 3983390..3985540 | + | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
PTQ22_RS19260 (3985635) | 3985635..3985838 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
PTQ22_RS19265 (3985849) | 3985849..3986805 | + | 957 | WP_000187838.1 | GTPase | - |
PTQ22_RS19270 (3986880) | 3986880..3987182 | - | 303 | WP_023254955.1 | BrnA antitoxin family protein | Antitoxin |
PTQ22_RS19275 (3987169) | 3987169..3987456 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
PTQ22_RS19280 (3987725) | 3987725..3988639 | - | 915 | WP_000290515.1 | restriction endonuclease | - |
PTQ22_RS19285 (3988837) | 3988837..3992346 | + | 3510 | WP_023256869.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T272052 WP_001131963.1 NZ_CP117696:c3987456-3987169 [Salmonella enterica subsp. enterica serovar London]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11346.01 Da Isoelectric Point: 10.1339
>AT272052 WP_023254955.1 NZ_CP117696:c3987182-3986880 [Salmonella enterica subsp. enterica serovar London]
MSMVKHKRGNACALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSGAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNACALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSGAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|