Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 844135..844795 | Replicon | chromosome |
Accession | NZ_CP117696 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain F1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A5I0Q7R2 |
Locus tag | PTQ22_RS04075 | Protein ID | WP_023255487.1 |
Coordinates | 844382..844795 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A3U5J6N8 |
Locus tag | PTQ22_RS04070 | Protein ID | WP_058805755.1 |
Coordinates | 844135..844401 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ22_RS04050 (840064) | 840064..841497 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
PTQ22_RS04055 (841655) | 841655..841966 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
PTQ22_RS04060 (842130) | 842130..842789 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
PTQ22_RS04065 (842905) | 842905..843885 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
PTQ22_RS04070 (844135) | 844135..844401 | + | 267 | WP_058805755.1 | FAD assembly factor SdhE | Antitoxin |
PTQ22_RS04075 (844382) | 844382..844795 | + | 414 | WP_023255487.1 | protein YgfX | Toxin |
PTQ22_RS04080 (844848) | 844848..845369 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
PTQ22_RS04085 (845482) | 845482..846378 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
PTQ22_RS04090 (846402) | 846402..847115 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PTQ22_RS04095 (847121) | 847121..848854 | + | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16197.18 Da Isoelectric Point: 10.7537
>T272042 WP_023255487.1 NZ_CP117696:844382-844795 [Salmonella enterica subsp. enterica serovar London]
VILWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VILWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0Q7R2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3U5J6N8 |