Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4294468..4295249 | Replicon | chromosome |
Accession | NZ_CP117693 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain S1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A5I1HVL4 |
Locus tag | PTQ18_RS20880 | Protein ID | WP_023255089.1 |
Coordinates | 4294468..4294959 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | PTQ18_RS20885 | Protein ID | WP_001271379.1 |
Coordinates | 4294956..4295249 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ18_RS20855 (4291349) | 4291349..4292179 | - | 831 | WP_079948288.1 | fimbria/pilus periplasmic chaperone | - |
PTQ18_RS20860 (4292381) | 4292381..4292686 | - | 306 | WP_000370555.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PTQ18_RS20865 (4293218) | 4293218..4293361 | + | 144 | Protein_4086 | transposase | - |
PTQ18_RS20870 (4293378) | 4293378..4293724 | + | 347 | Protein_4087 | Rpn family recombination-promoting nuclease/putative transposase | - |
PTQ18_RS20875 (4294005) | 4294005..4294253 | - | 249 | Protein_4088 | IS481 family transposase | - |
PTQ18_RS20880 (4294468) | 4294468..4294959 | - | 492 | WP_023255089.1 | GNAT family N-acetyltransferase | Toxin |
PTQ18_RS20885 (4294956) | 4294956..4295249 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
PTQ18_RS20890 (4295567) | 4295567..4295789 | + | 223 | Protein_4091 | hypothetical protein | - |
PTQ18_RS20895 (4296055) | 4296055..4296930 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
PTQ18_RS20900 (4296927) | 4296927..4297214 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PTQ18_RS20905 (4297237) | 4297237..4297451 | + | 215 | Protein_4094 | hypothetical protein | - |
PTQ18_RS20910 (4297459) | 4297459..4297602 | + | 144 | Protein_4095 | hypothetical protein | - |
PTQ18_RS20915 (4297714) | 4297714..4297803 | + | 90 | Protein_4096 | hypothetical protein | - |
PTQ18_RS20920 (4298092) | 4298092..4298997 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4283861..4297803 | 13942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17633.45 Da Isoelectric Point: 7.7297
>T272037 WP_023255089.1 NZ_CP117693:c4294959-4294468 [Salmonella enterica subsp. enterica serovar London]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT272037 WP_001271379.1 NZ_CP117693:c4295249-4294956 [Salmonella enterica subsp. enterica serovar London]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1HVL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |