Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4179887..4180403 | Replicon | chromosome |
Accession | NZ_CP117693 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain S1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5I6CHB9 |
Locus tag | PTQ18_RS20250 | Protein ID | WP_000220581.1 |
Coordinates | 4179887..4180171 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PTQ18_RS20255 | Protein ID | WP_000212724.1 |
Coordinates | 4180161..4180403 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ18_RS20235 (4175099) | 4175099..4176751 | + | 1653 | WP_023257400.1 | alpha,alpha-phosphotrehalase | - |
PTQ18_RS20240 (4177160) | 4177160..4179298 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PTQ18_RS20245 (4179419) | 4179419..4179883 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PTQ18_RS20250 (4179887) | 4179887..4180171 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTQ18_RS20255 (4180161) | 4180161..4180403 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PTQ18_RS20260 (4180481) | 4180481..4182394 | - | 1914 | WP_001212148.1 | BglG family transcription antiterminator | - |
PTQ18_RS20265 (4182411) | 4182411..4183151 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
PTQ18_RS20270 (4183148) | 4183148..4184266 | - | 1119 | WP_023256352.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PTQ18_RS20275 (4184250) | 4184250..4185383 | - | 1134 | WP_023257225.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T272036 WP_000220581.1 NZ_CP117693:c4180171-4179887 [Salmonella enterica subsp. enterica serovar London]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I6CHB9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |