Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3382053..3382673 | Replicon | chromosome |
Accession | NZ_CP117693 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain S1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PTQ18_RS16490 | Protein ID | WP_001280991.1 |
Coordinates | 3382455..3382673 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PTQ18_RS16485 | Protein ID | WP_000344807.1 |
Coordinates | 3382053..3382427 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ18_RS16475 (3377192) | 3377192..3378385 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PTQ18_RS16480 (3378408) | 3378408..3381557 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PTQ18_RS16485 (3382053) | 3382053..3382427 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PTQ18_RS16490 (3382455) | 3382455..3382673 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PTQ18_RS16495 (3382852) | 3382852..3383403 | + | 552 | WP_023243161.1 | maltose O-acetyltransferase | - |
PTQ18_RS16500 (3383521) | 3383521..3383991 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PTQ18_RS16505 (3384047) | 3384047..3384187 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PTQ18_RS16510 (3384193) | 3384193..3384453 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PTQ18_RS16515 (3384678) | 3384678..3386228 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
PTQ18_RS16525 (3386459) | 3386459..3386848 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PTQ18_RS16530 (3386881) | 3386881..3387450 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T272032 WP_001280991.1 NZ_CP117693:3382455-3382673 [Salmonella enterica subsp. enterica serovar London]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT272032 WP_000344807.1 NZ_CP117693:3382053-3382427 [Salmonella enterica subsp. enterica serovar London]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|