Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 852828..853453 | Replicon | chromosome |
| Accession | NZ_CP117693 | ||
| Organism | Salmonella enterica subsp. enterica serovar London strain S1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PTQ18_RS04125 | Protein ID | WP_000911337.1 |
| Coordinates | 853055..853453 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | PTQ18_RS04120 | Protein ID | WP_000557549.1 |
| Coordinates | 852828..853055 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTQ18_RS04090 (847893) | 847893..848991 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
| PTQ18_RS04095 (849001) | 849001..850518 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| PTQ18_RS04100 (850594) | 850594..851139 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| PTQ18_RS04105 (851404) | 851404..852162 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
| PTQ18_RS04115 (852408) | 852408..852605 | - | 198 | WP_023255488.1 | hypothetical protein | - |
| PTQ18_RS04120 (852828) | 852828..853055 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PTQ18_RS04125 (853055) | 853055..853453 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PTQ18_RS04130 (854259) | 854259..854795 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
| PTQ18_RS04135 (854842) | 854842..855474 | + | 633 | WP_000835264.1 | YfdX family protein | - |
| PTQ18_RS04140 (856193) | 856193..856777 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 852828..862645 | 9817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T272026 WP_000911337.1 NZ_CP117693:853055-853453 [Salmonella enterica subsp. enterica serovar London]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|