Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 7369..8013 | Replicon | plasmid pEA4_36 |
| Accession | NZ_CP117682 | ||
| Organism | Escherichia albertii strain BIA_4 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7L6LII1 |
| Locus tag | PS033_RS25020 | Protein ID | WP_000833471.1 |
| Coordinates | 7369..7551 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A7L6LHN8 |
| Locus tag | PS033_RS25025 | Protein ID | WP_000466317.1 |
| Coordinates | 7576..8013 (+) | Length | 146 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS033_RS24985 (PS033_24985) | 4376..4699 | + | 324 | WP_000432877.1 | hypothetical protein | - |
| PS033_RS24990 (PS033_24990) | 4740..4964 | + | 225 | WP_000866040.1 | hypothetical protein | - |
| PS033_RS24995 (PS033_24995) | 5060..5284 | + | 225 | WP_000749828.1 | hypothetical protein | - |
| PS033_RS25000 (PS033_25000) | 5335..5601 | + | 267 | WP_000868277.1 | hypothetical protein | - |
| PS033_RS25005 (PS033_25005) | 5591..5833 | + | 243 | WP_001450803.1 | hypothetical protein | - |
| PS033_RS25010 (PS033_25010) | 6273..6602 | + | 330 | WP_000387851.1 | hypothetical protein | - |
| PS033_RS25015 (PS033_25015) | 6660..6938 | + | 279 | WP_000545934.1 | hypothetical protein | - |
| PS033_RS25020 (PS033_25020) | 7369..7551 | + | 183 | WP_000833471.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PS033_RS25025 (PS033_25025) | 7576..8013 | + | 438 | WP_000466317.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PS033_RS25030 (PS033_25030) | 8042..8746 | - | 705 | WP_080171974.1 | hypothetical protein | - |
| PS033_RS25035 (PS033_25035) | 8743..9504 | - | 762 | WP_075319719.1 | conjugal transfer protein TraL | - |
| PS033_RS25040 (PS033_25040) | 9522..9923 | - | 402 | WP_181503405.1 | zinc transporter | - |
| PS033_RS25045 (PS033_25045) | 10292..10627 | + | 336 | WP_000963832.1 | DUF6290 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..36239 | 36239 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6675.97 Da Isoelectric Point: 11.0013
>T272021 WP_000833471.1 NZ_CP117682:7369-7551 [Escherichia albertii]
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
Download Length: 183 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16227.10 Da Isoelectric Point: 4.3135
>AT272021 WP_000466317.1 NZ_CP117682:7576-8013 [Escherichia albertii]
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LII1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LHN8 |