Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 62032..62675 | Replicon | plasmid pEA4_88 |
Accession | NZ_CP117680 | ||
Organism | Escherichia albertii strain BIA_4 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | PS033_RS24435 | Protein ID | WP_042093420.1 |
Coordinates | 62259..62675 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | PS033_RS24430 | Protein ID | WP_059268686.1 |
Coordinates | 62032..62262 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS033_RS24400 (57632) | 57632..57979 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
PS033_RS24405 (57979) | 57979..58626 | - | 648 | WP_059268691.1 | IS66-like element accessory protein TnpA | - |
PS033_RS24410 (58907) | 58907..59662 | - | 756 | WP_000807692.1 | replication initiation protein RepE | - |
PS033_RS24415 (60071) | 60071..60877 | - | 807 | WP_059268688.1 | site-specific integrase | - |
PS033_RS24420 (60878) | 60878..61183 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
PS033_RS24425 (61185) | 61185..61403 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
PS033_RS24430 (62032) | 62032..62262 | + | 231 | WP_059268686.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PS033_RS24435 (62259) | 62259..62675 | + | 417 | WP_042093420.1 | PIN domain-containing protein | Toxin |
PS033_RS24440 (62845) | 62845..64983 | - | 2139 | WP_059268683.1 | AAA family ATPase | - |
PS033_RS24445 (65548) | 65548..66504 | - | 957 | WP_187646074.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..88280 | 88280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 7.2450
>T272017 WP_042093420.1 NZ_CP117680:62259-62675 [Escherichia albertii]
VNKTYMLDTNICSFIMREQPEAVIRRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHGQLVDAFCARLDAILPWDRA
AVDATVEVKAALTAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTNICSFIMREQPEAVIRRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHGQLVDAFCARLDAILPWDRA
AVDATVEVKAALTAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|