Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 60878..61403 | Replicon | plasmid pEA4_88 |
| Accession | NZ_CP117680 | ||
| Organism | Escherichia albertii strain BIA_4 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | PS033_RS24420 | Protein ID | WP_001159871.1 |
| Coordinates | 60878..61183 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | PS033_RS24425 | Protein ID | WP_000813634.1 |
| Coordinates | 61185..61403 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS033_RS24395 (56046) | 56046..57612 | - | 1567 | Protein_72 | IS66 family transposase | - |
| PS033_RS24400 (57632) | 57632..57979 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS033_RS24405 (57979) | 57979..58626 | - | 648 | WP_059268691.1 | IS66-like element accessory protein TnpA | - |
| PS033_RS24410 (58907) | 58907..59662 | - | 756 | WP_000807692.1 | replication initiation protein RepE | - |
| PS033_RS24415 (60071) | 60071..60877 | - | 807 | WP_059268688.1 | site-specific integrase | - |
| PS033_RS24420 (60878) | 60878..61183 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PS033_RS24425 (61185) | 61185..61403 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PS033_RS24430 (62032) | 62032..62262 | + | 231 | WP_059268686.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PS033_RS24435 (62259) | 62259..62675 | + | 417 | WP_042093420.1 | PIN domain-containing protein | - |
| PS033_RS24440 (62845) | 62845..64983 | - | 2139 | WP_059268683.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..88280 | 88280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T272016 WP_001159871.1 NZ_CP117680:c61183-60878 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |