Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 49228..50003 Replicon plasmid pEA4_88
Accession NZ_CP117680
Organism Escherichia albertii strain BIA_4

Toxin (Protein)


Gene name tacT Uniprot ID A0A0C2EI97
Locus tag PS033_RS24355 Protein ID WP_000405250.1
Coordinates 49228..49710 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag PS033_RS24360 Protein ID WP_072146426.1
Coordinates 49701..50003 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS033_RS24320 (45063) 45063..45497 - 435 WP_059245512.1 hypothetical protein -
PS033_RS24325 (45567) 45567..45839 - 273 WP_215203002.1 type II toxin-antitoxin system toxin YacB -
PS033_RS24330 (45787) 45787..45972 - 186 Protein_59 hypothetical protein -
PS033_RS24335 (46819) 46819..47841 - 1023 WP_059268994.1 plasmid replication initiator RepA -
PS033_RS24340 (47831) 47831..48364 - 534 WP_040089446.1 plasmid replication initiator RepA -
PS033_RS24345 (48357) 48357..48431 - 75 WP_001365705.1 RepA leader peptide Tap -
PS033_RS24350 (48663) 48663..48920 - 258 WP_001136636.1 replication regulatory protein RepA -
PS033_RS24355 (49228) 49228..49710 - 483 WP_000405250.1 GNAT family N-acetyltransferase Toxin
PS033_RS24360 (49701) 49701..50003 - 303 WP_072146426.1 DUF1778 domain-containing protein Antitoxin
PS033_RS24365 (50324) 50324..50472 - 149 Protein_66 Hok/Gef family protein -
PS033_RS24370 (50536) 50536..51609 + 1074 WP_273780437.1 IS481 family transposase -
- (51611) 51611..51764 - 154 NuclAT_0 - -
- (51611) 51611..51764 - 154 NuclAT_0 - -
- (51611) 51611..51764 - 154 NuclAT_0 - -
- (51611) 51611..51764 - 154 NuclAT_0 - -
PS033_RS24375 (51904) 51904..52504 - 601 Protein_68 transposase -
PS033_RS24380 (52527) 52527..53141 + 615 Protein_69 transposase -
PS033_RS24385 (53427) 53427..53909 + 483 WP_059268697.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..88280 88280


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(30-149)

Antitoxin

Vibrio phage ICP1, Orf50

(15-99)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17649.42 Da        Isoelectric Point: 7.0386

>T272015 WP_000405250.1 NZ_CP117680:c49710-49228 [Escherichia albertii]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNASRTFVICLEGTLRVVGFYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNVAEQVGVKAVMVHAIDDDARAFYERFGFVQSVVAPDTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11648.21 Da        Isoelectric Point: 4.7174

>AT272015 WP_072146426.1 NZ_CP117680:c50003-49701 [Escherichia albertii]
MEVFMSTAASVRKTPRENQINIRATDEERAVIDYAASLVNKNRTDFIIELAYQEAKNIILDQRLFVLDNERYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C2EI97

Antitoxin

Source ID Structure

References