Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 68638..69239 | Replicon | plasmid pEA4_97 |
Accession | NZ_CP117679 | ||
Organism | Escherichia albertii strain BIA_4 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | PS033_RS23870 | Protein ID | WP_001216034.1 |
Coordinates | 68638..69018 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | PS033_RS23875 | Protein ID | WP_001190712.1 |
Coordinates | 69018..69239 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS033_RS23845 (PS033_23845) | 64079..65563 | - | 1485 | WP_273780393.1 | terminase | - |
PS033_RS23850 (PS033_23850) | 65563..66756 | - | 1194 | WP_273780395.1 | terminase | - |
PS033_RS23855 (PS033_23855) | 66842..67294 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
PS033_RS23860 (PS033_23860) | 67383..68426 | - | 1044 | WP_047655059.1 | DUF968 domain-containing protein | - |
PS033_RS23865 (PS033_23865) | 68454..68633 | - | 180 | WP_059268434.1 | hypothetical protein | - |
PS033_RS23870 (PS033_23870) | 68638..69018 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PS033_RS23875 (PS033_23875) | 69018..69239 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PS033_RS23880 (PS033_23880) | 69422..70977 | + | 1556 | Protein_74 | type I restriction-modification system subunit M | - |
PS033_RS23885 (PS033_23885) | 70974..72167 | + | 1194 | WP_059268435.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..97069 | 97069 | |
- | flank | IS/Tn | - | - | 62775..63962 | 1187 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T272014 WP_001216034.1 NZ_CP117679:c69018-68638 [Escherichia albertii]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |