Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4209634..4210252 | Replicon | chromosome |
Accession | NZ_CP117678 | ||
Organism | Escherichia albertii strain BIA_4 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PS033_RS20605 | Protein ID | WP_001280991.1 |
Coordinates | 4209634..4209852 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | PS033_RS20610 | Protein ID | WP_000344798.1 |
Coordinates | 4209878..4210252 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS033_RS20570 (4204916) | 4204916..4205488 | + | 573 | WP_059267833.1 | YbaY family lipoprotein | - |
PS033_RS20575 (4205518) | 4205518..4205829 | - | 312 | WP_000409915.1 | MGMT family protein | - |
PS033_RS20585 (4206210) | 4206210..4206563 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
PS033_RS20590 (4206601) | 4206601..4208151 | - | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
PS033_RS20595 (4208315) | 4208315..4208785 | - | 471 | WP_000136188.1 | YlaC family protein | - |
PS033_RS20600 (4208893) | 4208893..4209450 | - | 558 | WP_059221620.1 | maltose O-acetyltransferase | - |
PS033_RS20605 (4209634) | 4209634..4209852 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PS033_RS20610 (4209878) | 4209878..4210252 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
PS033_RS20615 (4210807) | 4210807..4213956 | - | 3150 | WP_059267834.1 | efflux RND transporter permease AcrB | - |
PS033_RS20620 (4213979) | 4213979..4215172 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T272013 WP_001280991.1 NZ_CP117678:c4209852-4209634 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT272013 WP_000344798.1 NZ_CP117678:c4210252-4209878 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|