Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 2733993..2734793 | Replicon | chromosome |
Accession | NZ_CP117678 | ||
Organism | Escherichia albertii strain BIA_4 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | PS033_RS13730 | Protein ID | WP_059220924.1 |
Coordinates | 2733993..2734520 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | PS033_RS13735 | Protein ID | WP_001277106.1 |
Coordinates | 2734527..2734793 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS033_RS13705 (2729068) | 2729068..2729835 | - | 768 | WP_273778032.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PS033_RS13710 (2729832) | 2729832..2731109 | - | 1278 | WP_273778035.1 | branched chain amino acid ABC transporter permease LivM | - |
PS033_RS13715 (2731106) | 2731106..2732032 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PS033_RS13720 (2732080) | 2732080..2733189 | - | 1110 | WP_059267945.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PS033_RS13725 (2733613) | 2733613..2733996 | + | 384 | WP_059267944.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
PS033_RS13730 (2733993) | 2733993..2734520 | - | 528 | WP_059220924.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
PS033_RS13735 (2734527) | 2734527..2734793 | - | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
PS033_RS13740 (2734943) | 2734943..2736046 | - | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
PS033_RS13745 (2736318) | 2736318..2737172 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
PS033_RS13750 (2737417) | 2737417..2738475 | - | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
PS033_RS13755 (2738468) | 2738468..2739136 | - | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19490.38 Da Isoelectric Point: 6.6303
>T272010 WP_059220924.1 NZ_CP117678:c2734520-2733993 [Escherichia albertii]
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|