272003

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 17925..18390 Replicon plasmid pKW21-2
Accession NZ_CP117674
Organism Escherichia coli strain KW21

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag PSR34_RS24775 Protein ID WP_001230707.1
Coordinates 17925..18176 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag PSR34_RS24780 Protein ID WP_000801440.1
Coordinates 18163..18390 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PSR34_RS24750 (PSR34_24750) 13406..13933 - 528 WP_000577043.1 DUF2726 domain-containing protein -
PSR34_RS24755 (PSR34_24755) 14068..14472 - 405 WP_012421203.1 hypothetical protein -
PSR34_RS24760 (PSR34_24760) 14485..15351 - 867 WP_001353743.1 replication initiation protein -
PSR34_RS24765 (PSR34_24765) 16766..17281 + 516 WP_001025395.1 J domain-containing protein -
PSR34_RS24770 (PSR34_24770) 17386..17928 + 543 WP_001083906.1 hypothetical protein -
PSR34_RS24775 (PSR34_24775) 17925..18176 + 252 WP_001230707.1 hypothetical protein Toxin
PSR34_RS24780 (PSR34_24780) 18163..18390 + 228 WP_000801440.1 hypothetical protein Antitoxin
PSR34_RS24785 (PSR34_24785) 18844..19143 + 300 WP_000650309.1 hypothetical protein -
PSR34_RS24790 (PSR34_24790) 19234..19584 + 351 WP_000854259.1 hypothetical protein -
PSR34_RS24795 (PSR34_24795) 19889..20138 + 250 Protein_25 type II toxin-antitoxin system HicA family toxin -
PSR34_RS24800 (PSR34_24800) 20135..20482 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
PSR34_RS24805 (PSR34_24805) 20843..21346 + 504 WP_000781813.1 relaxosome-coupling protein TaxA -
PSR34_RS24810 (PSR34_24810) 21350..22579 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
PSR34_RS24815 (PSR34_24815) 22656..22949 + 294 WP_060598542.1 sigma factor-like helix-turn-helix DNA-binding protein -
PSR34_RS24820 (PSR34_24820) 22946..23161 + 216 WP_000760375.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..33310 33310


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T272003 WP_001230707.1 NZ_CP117674:17925-18176 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT272003 WP_000801440.1 NZ_CP117674:18163-18390 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References