Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 44496..45121 | Replicon | plasmid pKW21 |
| Accession | NZ_CP117673 | ||
| Organism | Escherichia coli strain KW21 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PSR34_RS23930 | Protein ID | WP_000911313.1 |
| Coordinates | 44496..44894 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | PSR34_RS23935 | Protein ID | WP_000450520.1 |
| Coordinates | 44894..45121 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSR34_RS23915 (40821) | 40821..41318 | + | 498 | WP_000605857.1 | entry exclusion protein | - |
| PSR34_RS23920 (41350) | 41350..42081 | + | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| PSR34_RS23925 (42334) | 42334..44487 | + | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
| PSR34_RS23930 (44496) | 44496..44894 | - | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PSR34_RS23935 (44894) | 44894..45121 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / aph(3')-Ia / mph(A) / oqxA / oqxB / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaCTX-M-55 / fosA3 / dfrA14 / dfrA12 / aadA2 / sitABCD | iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB | 1..179817 | 179817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T271999 WP_000911313.1 NZ_CP117673:c44894-44496 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|