Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3549369..3549987 | Replicon | chromosome |
Accession | NZ_CP117672 | ||
Organism | Escherichia coli strain KW21 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PSR34_RS17335 | Protein ID | WP_001291435.1 |
Coordinates | 3549769..3549987 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PSR34_RS17330 | Protein ID | WP_000344800.1 |
Coordinates | 3549369..3549743 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR34_RS17320 (3544897) | 3544897..3548046 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PSR34_RS17325 (3548297) | 3548297..3548994 | + | 698 | WP_223216367.1 | IS1 family transposase | - |
PSR34_RS17330 (3549369) | 3549369..3549743 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PSR34_RS17335 (3549769) | 3549769..3549987 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PSR34_RS17340 (3550159) | 3550159..3550710 | + | 552 | WP_040091271.1 | maltose O-acetyltransferase | - |
PSR34_RS17345 (3550826) | 3550826..3551296 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PSR34_RS17350 (3551460) | 3551460..3553010 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PSR34_RS17355 (3553052) | 3553052..3553405 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
PSR34_RS17365 (3553784) | 3553784..3554095 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PSR34_RS17370 (3554126) | 3554126..3554698 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T271991 WP_001291435.1 NZ_CP117672:3549769-3549987 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT271991 WP_000344800.1 NZ_CP117672:3549369-3549743 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |