Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1324069..1324694 | Replicon | chromosome |
Accession | NZ_CP117672 | ||
Organism | Escherichia coli strain KW21 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PSR34_RS06380 | Protein ID | WP_000911330.1 |
Coordinates | 1324296..1324694 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PSR34_RS06375 | Protein ID | WP_000450524.1 |
Coordinates | 1324069..1324296 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR34_RS06350 (1319871) | 1319871..1320341 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
PSR34_RS06355 (1320341) | 1320341..1320913 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PSR34_RS06360 (1321059) | 1321059..1321937 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PSR34_RS06365 (1321954) | 1321954..1322988 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PSR34_RS06370 (1323201) | 1323201..1323914 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PSR34_RS06375 (1324069) | 1324069..1324296 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PSR34_RS06380 (1324296) | 1324296..1324694 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PSR34_RS06385 (1324841) | 1324841..1325704 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
PSR34_RS06390 (1325719) | 1325719..1327734 | + | 2016 | WP_032283657.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PSR34_RS06395 (1327808) | 1327808..1328506 | + | 699 | WP_000679823.1 | esterase | - |
PSR34_RS06400 (1328616) | 1328616..1328816 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T271984 WP_000911330.1 NZ_CP117672:1324296-1324694 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|