Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 856140..856794 | Replicon | chromosome |
Accession | NZ_CP117672 | ||
Organism | Escherichia coli strain KW21 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | PSR34_RS04220 | Protein ID | WP_000244781.1 |
Coordinates | 856387..856794 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PSR34_RS04215 | Protein ID | WP_000354046.1 |
Coordinates | 856140..856406 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR34_RS04190 (851309) | 851309..852052 | + | 744 | WP_000951961.1 | SDR family oxidoreductase | - |
PSR34_RS04195 (852109) | 852109..853542 | - | 1434 | WP_032283547.1 | 6-phospho-beta-glucosidase BglA | - |
PSR34_RS04200 (853587) | 853587..853898 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
PSR34_RS04205 (854062) | 854062..854721 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
PSR34_RS04210 (854917) | 854917..855897 | - | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
PSR34_RS04215 (856140) | 856140..856406 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PSR34_RS04220 (856387) | 856387..856794 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
PSR34_RS04225 (856834) | 856834..857355 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
PSR34_RS04230 (857467) | 857467..858363 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PSR34_RS04235 (858388) | 858388..859098 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PSR34_RS04240 (859104) | 859104..860837 | + | 1734 | WP_000813223.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T271982 WP_000244781.1 NZ_CP117672:856387-856794 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|