Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 55519..56144 | Replicon | plasmid pEA11_1 |
| Accession | NZ_CP117669 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PS054_RS23905 | Protein ID | WP_273815637.1 |
| Coordinates | 55519..55917 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8H9EG71 |
| Locus tag | PS054_RS23910 | Protein ID | WP_000450526.1 |
| Coordinates | 55917..56144 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS23865 (50789) | 50789..52216 | + | 1428 | WP_273815723.1 | F-type conjugal transfer pilus assembly protein TraB | - |
| PS054_RS23870 (52206) | 52206..52796 | + | 591 | WP_273815725.1 | conjugal transfer pilus-stabilizing protein TraP | - |
| PS054_RS23875 (52783) | 52783..53103 | + | 321 | WP_273815727.1 | conjugal transfer protein TrbD | - |
| PS054_RS23880 (53096) | 53096..53347 | + | 252 | WP_273815728.1 | conjugal transfer protein TrbG | - |
| PS054_RS23885 (53344) | 53344..53859 | + | 516 | WP_273815730.1 | type IV conjugative transfer system lipoprotein TraV | - |
| PS054_RS23890 (53994) | 53994..54215 | + | 222 | WP_213852945.1 | conjugal transfer protein TraR | - |
| PS054_RS23895 (54543) | 54543..54590 | + | 48 | Protein_62 | hypothetical protein | - |
| PS054_RS23900 (54639) | 54639..55577 | + | 939 | Protein_63 | type IV secretion system DNA-binding domain-containing protein | - |
| PS054_RS23905 (55519) | 55519..55917 | - | 399 | WP_273815637.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PS054_RS23910 (55917) | 55917..56144 | - | 228 | WP_000450526.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | vat | 1..110945 | 110945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14885.20 Da Isoelectric Point: 8.5264
>T271978 WP_273815637.1 NZ_CP117669:c55917-55519 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPVSVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPVSVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|