Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2750212..2751012 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | PS054_RS13840 | Protein ID | WP_095574314.1 |
| Coordinates | 2750212..2750739 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | PS054_RS13845 | Protein ID | WP_001277106.1 |
| Coordinates | 2750746..2751012 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS13815 (2745288) | 2745288..2746055 | - | 768 | WP_000083515.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PS054_RS13820 (2746052) | 2746052..2747329 | - | 1278 | WP_273813827.1 | branched chain amino acid ABC transporter permease LivM | - |
| PS054_RS13825 (2747326) | 2747326..2748252 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PS054_RS13830 (2748300) | 2748300..2749409 | - | 1110 | WP_273813829.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PS054_RS13835 (2749832) | 2749832..2750215 | + | 384 | WP_095574313.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| PS054_RS13840 (2750212) | 2750212..2750739 | - | 528 | WP_095574314.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| PS054_RS13845 (2750746) | 2750746..2751012 | - | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| PS054_RS13850 (2751162) | 2751162..2752265 | - | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| PS054_RS13855 (2752537) | 2752537..2753391 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| PS054_RS13860 (2753636) | 2753636..2754694 | - | 1059 | WP_113650495.1 | permease-like cell division protein FtsX | - |
| PS054_RS13865 (2754687) | 2754687..2755355 | - | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19464.36 Da Isoelectric Point: 6.6263
>T271963 WP_095574314.1 NZ_CP117668:c2750739-2750212 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRACILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRACILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|