Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2162279..2162930 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | PS054_RS10935 | Protein ID | WP_000244763.1 |
| Coordinates | 2162279..2162683 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS054_RS10940 | Protein ID | WP_000354046.1 |
| Coordinates | 2162664..2162930 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS10915 (2158237) | 2158237..2159970 | - | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PS054_RS10920 (2159976) | 2159976..2160686 | - | 711 | WP_273815377.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS054_RS10925 (2160711) | 2160711..2161607 | - | 897 | WP_273815378.1 | site-specific tyrosine recombinase XerD | - |
| PS054_RS10930 (2161719) | 2161719..2162240 | + | 522 | WP_059221135.1 | flavodoxin FldB | - |
| PS054_RS10935 (2162279) | 2162279..2162683 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
| PS054_RS10940 (2162664) | 2162664..2162930 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS054_RS10945 (2162920) | 2162920..2163150 | - | 231 | WP_000181267.1 | hypothetical protein | - |
| PS054_RS10950 (2163182) | 2163182..2164162 | + | 981 | WP_059221136.1 | tRNA-modifying protein YgfZ | - |
| PS054_RS10955 (2164364) | 2164364..2165023 | - | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS054_RS10960 (2165191) | 2165191..2165502 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS054_RS10965 (2165547) | 2165547..2166980 | + | 1434 | WP_164508673.1 | 6-phospho-beta-glucosidase BglA | - |
| PS054_RS10970 (2167027) | 2167027..2167920 | - | 894 | WP_059221140.1 | transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271962 WP_000244763.1 NZ_CP117668:c2162683-2162279 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6P9B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |