Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1896818..1897555 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8H9B962 |
| Locus tag | PS054_RS09640 | Protein ID | WP_038869372.1 |
| Coordinates | 1897175..1897555 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PS054_RS09635 | Protein ID | WP_273815296.1 |
| Coordinates | 1896818..1897144 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS09605 (1892854) | 1892854..1893729 | + | 876 | WP_273815285.1 | GTPase family protein | - |
| PS054_RS09610 (1893942) | 1893942..1894643 | + | 702 | WP_273815286.1 | WYL domain-containing protein | - |
| PS054_RS09615 (1894649) | 1894649..1895278 | + | 630 | WP_273815288.1 | hypothetical protein | - |
| PS054_RS09620 (1895332) | 1895332..1895775 | + | 444 | WP_273815290.1 | IrmA family protein | - |
| PS054_RS09625 (1895906) | 1895906..1896325 | + | 420 | WP_273815292.1 | antirestriction protein | - |
| PS054_RS09630 (1896340) | 1896340..1896807 | + | 468 | WP_038869371.1 | DNA repair protein RadC | - |
| PS054_RS09635 (1896818) | 1896818..1897144 | + | 327 | WP_273815296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS054_RS09640 (1897175) | 1897175..1897555 | + | 381 | WP_038869372.1 | TA system toxin CbtA family protein | Toxin |
| PS054_RS09645 (1897724) | 1897724..1897798 | + | 75 | Protein_1891 | hypothetical protein | - |
| PS054_RS09650 (1898098) | 1898098..1898160 | + | 63 | Protein_1892 | integrase | - |
| PS054_RS09655 (1898775) | 1898775..1898876 | + | 102 | WP_000662203.1 | small membrane protein YkgR | - |
| PS054_RS09660 (1899335) | 1899335..1899601 | + | 267 | WP_000812362.1 | type B 50S ribosomal protein L31 | - |
| PS054_RS09665 (1899598) | 1899598..1899738 | + | 141 | WP_000866440.1 | type B 50S ribosomal protein L36 | - |
| PS054_RS09675 (1900845) | 1900845..1902017 | + | 1173 | Protein_1896 | NADP-dependent succinate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14142.20 Da Isoelectric Point: 7.9069
>T271960 WP_038869372.1 NZ_CP117668:1897175-1897555 [Escherichia albertii]
MQTLPLPEPRAARPCPSPVQVWQLLLTHLLNKHYGLTLNDTPFGDDRVIQAHINAGISLCDAVNFIVERYELVRIDHSRF
GLTERSSLIGAIDILRARRATGLIVSSGYSTITRITTGRYWEDTAQ
MQTLPLPEPRAARPCPSPVQVWQLLLTHLLNKHYGLTLNDTPFGDDRVIQAHINAGISLCDAVNFIVERYELVRIDHSRF
GLTERSSLIGAIDILRARRATGLIVSSGYSTITRITTGRYWEDTAQ
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|